PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr017593.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NF-YB
Protein Properties Length: 59aa    MW: 6247.04 Da    PI: 8.5225
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr017593.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB67.91.9e-211358248
        NF-YB  2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvts 48
                 r+qdrflPi nvsrimk+  Panakiskdaketv+ec+sefisf+t+
  Pbr017593.1 13 RKQDRFLPI-NVSRIMKNGSPANAKISKDAKETVKECISEFISFITG 58
                 89******9.9**********************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.9E-18757IPR009072Histone-fold
SuperFamilySSF471131.87E-111357IPR009072Histone-fold
PfamPF008084.5E-121857IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 59 aa     Download sequence    Send to blast
MADSDNDSGG GARKQDRFLP INVSRIMKNG SPANAKISKD AKETVKECIS EFISFITG*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_193190.14e-25nuclear transcription factor Y subunit B-3
RefseqXP_002870307.14e-25CCAAT-box binding transcription factor subunit B (NF-YB) family
RefseqXP_010440452.14e-25PREDICTED: nuclear transcription factor Y subunit B-3-like
RefseqXP_010450027.14e-25PREDICTED: nuclear transcription factor Y subunit B-3
RefseqXP_013639202.14e-25PREDICTED: nuclear transcription factor Y subunit B-3-like
SwissprotO233105e-27NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLA0A0J8BLH65e-26A0A0J8BLH6_BETVU; Uncharacterized protein
STRINGAT4G14540.11e-24(Arabidopsis thaliana)
STRINGfgenesh2_kg.7__2885__AT4G14540.11e-24(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.13e-28nuclear factor Y, subunit B3